SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_2530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_2530
Domain Number 1 Region: 39-132
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_2530
Sequence length 155
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MVAVGTKTIYRPLTAVTDEQERCGHATFAVRRCSAHRMAIAVIGEIDAVNGRALGRYVER
HTRISRQLVLDLRAVDFFGSQGFTALYYISVHCARSDVDWVIVGSPAVRRLLAICDPDGE
LPLTDALSSALARLDRLAHGGQHLVWTAKSGWHAR
Download sequence
Identical sequences A1T841
WP_011779750.1.45031 gi|120403518|ref|YP_953347.1| 350058.Mvan_2530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]