SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_2758 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_2758
Domain Number 1 Region: 82-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000876
Family NfeD domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_2758
Sequence length 144
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MPVSLIWLIAALALAGAEALTGDLFLLMLSGGALAAAGSSFLLNWPIWADGIVFLLVSVL
LLVGVRPALRRRLMSGRGLPEPAKALEGKSALVLDRVAIHEGQVKLDGEVWTARPYNEND
VFEPGDHVTVVHIDGATAVVAKIG
Download sequence
Identical sequences A1T8R5
350058.Mvan_2758 gi|120403742|ref|YP_953571.1| WP_011779973.1.45031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]