SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_4700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_4700
Domain Number 1 Region: 38-131
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000128
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_4700
Sequence length 135
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MTVTSIRSRSADCRRFSIASTSLTFACRTEGAGSATRATVSVWGEVDAANAKHFAHTVRE
VAEGNAALILDLSEVNFMAFDGASALYAISAQLAREGVTWCVIASPAVSRVLELCDPEGL
IPATTIPSVRGAKPA
Download sequence
Identical sequences A1TE75
gi|120405652|ref|YP_955481.1| 350058.Mvan_4700 WP_011781850.1.45031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]