SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_5807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_5807
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.08e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_5807
Sequence length 116
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MKLTLTVHITGRSARVHVAGDLDYGSTGLLLETVSELLVDPSGWQDLHLDFTDLAFCDSA
GLSSLVVIHRRTTAAGIRLHLDHRPAQLERILRVTGLLEFLTTRPASLDSDESDIG
Download sequence
Identical sequences A1THC2
WP_011782923.1.45031 WP_011782923.1.58012 350058.Mvan_5807 gi|120406749|ref|YP_956578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]