SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350688.Clos_0071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350688.Clos_0071
Domain Number 1 Region: 4-191
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 350688.Clos_0071
Sequence length 192
Comment (Alkaliphilus oremlandii OhILAs)
Sequence
MSEVKSLLLVGVGGQGTILASKILSAGLLDAGYDVKMSEVHGMAQRGGSVTTQVRYGKKV
HAPIIGKGQADILVSFEAMEALRWLEFLNPKGRAVVNDFKIPSAPILMGNVDYPEGVIET
IKEKVNTSILDAGQIAERIGNPKTMNIVLLGALVKAMGLTDIDWEKAIRENVKEQFVEIN
IKAFEEGMKAVA
Download sequence
Identical sequences A8MEH0
gi|158319130|ref|YP_001511637.1| 350688.Clos_0071 WP_012157956.1.49300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]