SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350688.Clos_1241 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350688.Clos_1241
Domain Number 1 Region: 12-191
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.05e-22
Family Crotonase-like 0.035
Further Details:      
 
Domain Number 2 Region: 368-429
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000157
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 350688.Clos_1241
Sequence length 430
Comment (Alkaliphilus oremlandii OhILAs)
Sequence
MNRKKICVVLLLMLLLSVVAASGDQGAGNVYVIPIRGEITPAMHLYVKHNLSIVESDKNA
TAVIFEIDTYGGRIDSSEQIGKLILNTNIPTISFVNTKAESAGVLLTISSDTIAMAPSST
IGSAETVPNTEKVLSTWVGILRSTAQKTGRDETIVSAMADKSVVIPGVSERGRLLNLTNV
DAILLDFIDFIANDYNEVLDYLSLSDHHIIMAETTNSIRLAQFASNLYIAPILLAIGIIG
ILIELFMPGFGIGGTIGLISLAVYFAGNMLAGNGNFATVLIFVLGIILLITEAAMPGFGI
AGIGGVLCIGVSIFLISNSIVTAVLSVTVILILTIIAILLLYKFAPKNKYFNRIILNAKL
DKNKGYTSTVDYSKYVNQTGIVTTALRPSGIISIDGELLDVVSEGQFIEKDEIVMVSKVE
GRKIVVRKMN
Download sequence
Identical sequences A8MG59
WP_012159099.1.49300 gi|158320276|ref|YP_001512783.1| 350688.Clos_1241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]