SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI21811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI21811
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily UBC-like 2.68e-51
Family UBC-related 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI21811
Sequence length 161
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MSSSGIARGRLAEERKAWRRDHPYGFYARPVSRGDGSSDLMKWETGIPGKEGTDWESGVY
KVMLEFSDEYPSKPPKCKFVPPLFHPNVYPSGTICLSILNEEEGWRPAITVKQMLLGIQD
LLDTPNPNSPAQSEAYNLFINNKAEYKRRVKAEARKNTPST
Download sequence
Identical sequences B8BY49
jgi|Thaps3|21811|estExt_fgenesh1_pg.C_chr_30493 35128.JGI21811 XP_002288880.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]