SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI2376 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI2376
Domain Number 1 Region: 180-309
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.13e-31
Family Galactokinase 0.054
Further Details:      
 
Domain Number 2 Region: 9-194
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.57e-28
Family GHMP Kinase, N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI2376
Sequence length 315
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MADDFPIHQTHAYGKLILFGEHFVVYKVPALVGAVSAYTDCKVEYLNEPGLEVVDNRPAV
PLYKEQKMEEGMEAINLTLKHLGVDTQKRGMKLTFGGDLCCASGIGASAAQVVSLARAFN
VVDGRSMTEDEINAAGYEGEKGYHGTPSGIDNTAATFGGLLRFQRTDGAPIFDKKSLKSP
IRIVYASTGITASTTKVVGDVRAKKEADEAWFANLMEQYKVLVEDGQTAVEAGDLTTLGK
LMDQNHVLLQELTVSCKELDDLVAAAREAGALGAKMSGTGRGGLMIALTPTEEIQSAVAD
ALGELAPQVWKTTFA
Download sequence
Identical sequences B8BU66
35128.JGI2376 XP_002287787.1.2071 jgi|Thaps3|2376|fgenesh1_pg.C_chr_2000331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]