SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 35128.JGI261754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  35128.JGI261754
Domain Number - Region: 462-523
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000334
Family Anti-sigma factor antagonist SpoIIaa 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI261754
Sequence length 525
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
IPAIALITLFHLMVSIPFGVSYFPVRWKRKEALGIRMFLFSTIIGQLAMTFASNFNNCIA
LQMVENVPFTISLSYIVIEEQGYGKEALSTLFFLFGLASMIVGVVFYLLGRYEMGRILYF
FPAHVLVGCIGGIGVFIAKTGLEVTANRSFSLDVSGISSFVDRFHLLLVVFGFEVGLRLL
NYSTRDSSGKAKYPLLSPVYFCLITPVFYLGIWLAGKSTESALEEGYFFPPLTDEGTVWD
IFHMVNLSSVSFTAVFQSIPTLLALVLFSLIHVPINIPAFAVSTDVDVDMNIELMAHGWS
NSIVGVFGGLQNYMAYTQSIIYYKSGGKGKTSSLAVAIVTTILFFIGPAIASYMPRCMAG
TLLLHCGVDLFLEGVRDSYGHYDYLEYIGIWTITIVMTLSGMEAALLAGVISALLTYAIQ
SVTYPKPIRGSMTAATLRSSAWNRCPEAFEILDSKENGRVKIFVIQLQGHLFFGNISIFS
DGVKKRIQTFPRDERPIIVIIDFTLVLGIDSSAAQAIIKLRDYLS
Download sequence
Identical sequences B8BXL5
jgi|Thaps3|261754|thaps1_ua_kg.chr_3000132 XP_002288289.1.2071 35128.JGI261754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]