SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351348.Maqu_0118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351348.Maqu_0118
Domain Number 1 Region: 39-151,180-238
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.79e-27
Family Clp protease, ClpP subunit 0.035
Further Details:      
 
Domain Number 2 Region: 411-477
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000484
Family NfeD domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351348.Maqu_0118
Sequence length 488
Comment (Marinobacter aquaeolei VT8)
Sequence
MRASQFRTSTLTPRVKLWALVFVAGALLALFSLSLKVFAQQESPRQALVLSVDGAIGPAT
MDYVTRGIRRAERESAGLVVIEMDTPGGLMDSMREIIKTILASDVPVATYVSPQGARAAS
AGTYILYGSHIAAMAPATNLGSATPVQMGGLPGSTEPESPSESAPEESSEDTDQSESADK
RRGNTAMERKVLEDAVSYIRGLAERHGRNADWAEEAVREAVNLGATEALERNVVDVVVPN
LRALLSEIDGRTVRLAAGDRVLETAQLELVRAEPDWRTKLLSVITDPNVAYFLMIIGFYG
ILFELANPGAVVPGVIGAISLILALFAFQVLSVNYAGLALILLGLAFIVGEAFVPSFGIL
GIGGIVAFVTGSVILMDGSHQDISLPTIGGTAVVAGGFILWTVTRFIGLRRRHPVSGSEQ
LVHEHGVALDDFVPTYDAYAGHVRVSGERWNARSQEAIAARSQVRVNGMDGLTLLVEPGT
DEPAERTD
Download sequence
Identical sequences A1TWV6
351348.Maqu_0118 gi|120553061|ref|YP_957412.1| WP_011783698.1.7233 WP_011783698.1.74965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]