SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_1511 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351605.Gura_1511
Domain Number 1 Region: 12-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_1511
Sequence length 104
Comment (Geobacter uraniumreducens Rf4)
Sequence
MDALLHIVPDRFPQYDYFALNGNIDAQAEKQLKELPAKVKQPKVTIDFSKTGRINSMGIA
LLLRCFKAIREEKKADIELVGLTPMNTMLFKMTGIFLLATPAKV
Download sequence
Identical sequences A5GE55
WP_011938423.1.63777 gi|148263577|ref|YP_001230283.1| 351605.Gura_1511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]