SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_1796 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  351605.Gura_1796
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0183
Family NfeD domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_1796
Sequence length 137
Comment (Geobacter uraniumreducens Rf4)
Sequence
MRVRKLLLLAGLLVLTNCFFSVCATADAGALKITEMAVTTKIVKGNPIDSVRRISSTSVK
ALYCFTRLSASKDEDTTIKHVWYKNDEVVGEYELPVKGQHWRTYSRKQVEKVAAGDWRVE
VLDSEGNLLKTVKFRMN
Download sequence
Identical sequences A5GEY1
WP_011938691.1.63777 351605.Gura_1796 gi|148263853|ref|YP_001230559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]