SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_2637 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  351605.Gura_2637
Domain Number - Region: 32-123
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00576
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_2637
Sequence length 401
Comment (Geobacter uraniumreducens Rf4)
Sequence
MAWFSHYEMVLIRHRQSVIEKGACHSMIPSELKIDKTPDGALLTLAGDWRLGSAIPSPDG
VIAGLGAAEKGQRLAFETGNLQGWDSGLLVFLAKLFDICRRNGISVDESGLPAGVRKLID
LASPEKQRSGVTHGGEHPSFLVWVADTALAQVKGAKEVLAFIGEATLAFVKMLRGKADFR
RMDLIVTIQETGAQALPIVTLISLLVGMILAFIASIQLKMFGAQIYVADVVGIGIVRVMG
AIMTGIIMSGRTGAAFAAQLGTMQVNEEIDALETLGFSPVEFLVLPRMLALMLMMPLLCV
YSDLMGVLGGMIVGVGMLDLGFMEYVHQSRSALNLTHFLVGLFHSFVFGILVAVAGCLRG
LQCERSASAVGYAATSAVVTGIVCIVVATAIITLSCQVLGI
Download sequence
Identical sequences A5G4U6
351605.Gura_2637 WP_011939491.1.63777 gi|148264681|ref|YP_001231387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]