SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_2913 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351605.Gura_2913
Domain Number 1 Region: 5-185
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.56e-27
Family Crotonase-like 0.036
Further Details:      
 
Domain Number 2 Region: 357-422
Classification Level Classification E-value
Superfamily NfeD domain-like 1.44e-20
Family NfeD domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_2913
Sequence length 423
Comment (Geobacter uraniumreducens Rf4)
Sequence
MLRLLILTLFIMTYSFPAVAGKGVVRSIDINGPINPVTADYLKRNLREAARSNEMLLLVE
MDTPGGLDSAMRDSVKDVMASPVPVVVYVAPSGARAASAGAVIALAADICAMAPGTNIGA
AHPVSIGEKPDKVMQEKLVNDAEAYVEGIARKRGRNEVLAKQMVRESLSLSAEKALEGKV
IDLIAADRGELLRKLDGRNVLRNGKSVALDLTGAEVKEYEMATREKILNVISNPNVAYVL
MMLGFLGIFFELSNPGVILPGVIGGISLILAFFAFQTLPVNYAGVLLILLAIVLFIAEIK
IVSHGMLTVGGVISMILGSLLLFESPEPYLRVSWSVIIVTVLATTVFAVCAVTLAVKAHR
RKPVSGREGLIGETGRAETAIDPEGKVFVRGEYWQAFSDEQIAPNDKIEVVAVDGMRVKV
KKA
Download sequence
Identical sequences A5G5L7
351605.Gura_2913 WP_011939755.1.63777 gi|148264952|ref|YP_001231658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]