SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_3436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351605.Gura_3436
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000301
Family NfeD domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_3436
Sequence length 152
Comment (Geobacter uraniumreducens Rf4)
Sequence
MNILWWHWLVVGMVLIGLELVVPSFTIIWFGLGAVLVGIVMVFAPGYPLPAQILTWTVVS
AVLTIAWFRFFNPRSNKTFSGSAKGAVVGETGLVIRAAEPYARGTVKFQLPLLGADEWPC
MAEESLKVGDRVKIVDVEGHVMKVEKTGKGVD
Download sequence
Identical sequences A5G724
WP_011940253.1.63777 351605.Gura_3436 gi|148265459|ref|YP_001232165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]