SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_3483 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351605.Gura_3483
Domain Number 1 Region: 797-1184
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-127
Family PFOR PP module 0.0000000148
Further Details:      
 
Domain Number 2 Region: 419-671
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.06e-79
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000385
Further Details:      
 
Domain Number 3 Region: 1-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.47e-74
Family PFOR Pyr module 0.0000000487
Further Details:      
 
Domain Number 4 Region: 255-414
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.43e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000126
Further Details:      
 
Domain Number 5 Region: 669-840
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.16e-19
Family Ferredoxin domains from multidomain proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_3483
Sequence length 1186
Comment (Geobacter uraniumreducens Rf4)
Sequence
MVTIDGNTAAAHVAHATNEVIAIYPITPSSVMGEISDAKSAVGEKNIWGTVPLVSELQSE
GGAAGTVHGALQSGALTTTFTASQGLLLMIPNMYKIAGELTSTVFHVSARAIATQALSIF
GDHSDVMSCRSTGWAMLCSNNVQEVMDFALIAQAATLRSRVPFLHFFDGFRTSHEVQKVE
ELTFDDMRAMIDDRLVNAHRSRGLSPDRPVMRGTAQNPDVYFQGRETVNQFYPACFDIVQ
EEMDKFASITGRSYKLVEYVGATDAERVVVIMGSGADTVQETVQTLVEQGEKVGVVKVHL
YRPFPLDAFIKALPKTVQKIAVLDRTKEPGSLGEPLYLDVRAAIGEAMADGICELAGYPT
IVGGRYGLGSKEFTPSMAKAVFDNLKDTKPKKNFVVGINEDVTNSSLAFDPAFRNAMDGT
YEAMFYGLGSDGTVGANKNTIKIIGETTNNFAQAYFVYDSKKAGSITTSHLRFGTQPINA
PYLIDNADFIACHNFTFLEKYDMLSKAKPGGTFLLCSPFAHGEVWDRIPVEVQQQIIDKQ
LKFFVINAIKLGEELGLGARINVIMQTAFFKISNIIPLEQAINEIKGAIKKSYGKAGEKV
VAMNNAAVDEALKNIHEVAVPAKATSHITMPPSVSGNSPKFVQEVTGKIIAGFGDDLPVS
AMPIDGTFPTATSQFEKRNIAVDIPVWDEKLCIQCAICSFVCPHAAIRVKAYPDECLKGA
PATFKSTDSRIAEVKEMKITFQVAPEDCTGCGACAHNCPARDKANPEHKALDMKFQPPLR
AAEAANYEFFLALPDMDPALLKLDTLRGSQLVRPVFEYSGACAGCGETPYLKLLSQLFGD
RAMIANATGCTSIYGGNLPTTPWAKRADGRGPAWSNSLFEDNAEFGFGMRLAVDKFTESA
RELLTELLTCGCNSCTPLIPLMKEILASGQNGQAEIEQQRERVAQLKQALTGCTEKAAVQ
LLPLADYLVRKSVWCIGGDGWAYDIGYGGLDHVIASGKNVNILVLDTEVYSNTGGQASKS
TPIGAVAQFAAGGKVMAKKDLGMMAMAYGHVYVAAVSLANPGQVVKAFMEAEAHDGPSII
IAYAHCIAHGINMTTAVDEQKRAVSSGYWPLYRYNPALAAEGKNPLQLDSQAPTTSFEEF
ANGENRYRVLKKINPEASARLMEKASAWTAGRFEYYQKLAALTYGK
Download sequence
Identical sequences A5G770
gi|148265505|ref|YP_001232211.1| 351605.Gura_3483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]