SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 351627.Csac_1052 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351627.Csac_1052
Domain Number 1 Region: 188-317
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.31e-40
Family NlpC/P60 0.0017
Further Details:      
 
Weak hits

Sequence:  351627.Csac_1052
Domain Number - Region: 131-169
Classification Level Classification E-value
Superfamily SH3-domain 0.000554
Family SH3-domain 0.0038
Further Details:      
 
Domain Number - Region: 54-90
Classification Level Classification E-value
Superfamily SH3-domain 0.00249
Family SH3-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351627.Csac_1052
Sequence length 318
Comment (Caldicellulosiruptor saccharolyticus DSM 8903)
Sequence
MNTKALIGILMFLLLITWSSKGFAKTAEATVTVNIRNSPSTSSKVLGVFPKGFKAQVLSS
TGGWVKISFDGVVGYVKSDYIKLTKDSSTSNAVKSSTNTRQVVSQMPMATVLKDNARVRS
NMSTSSKILKTLKKGSKVYVLARERNGWIKVKTLDGTVGYMAYYLLKMSTSHTTKISSRG
GYDREAQVAYNGSLADRILGFAKNLLGIRYRYGGSSPSTGFDCSGFVQYVFRNFGISLER
TAADMAATDGVRISYNELRPGDLVFFDTDGGRNYINHVGIYLGGGKYIHASSARGCVTIS
DLTSKYGTSFMMAKRVIR
Download sequence
Identical sequences A4XID1
351627.Csac_1052 gi|146296086|ref|YP_001179857.1| ClR67 WP_011916613.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]