SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351627.Csac_1114 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  351627.Csac_1114
Domain Number - Region: 10-53
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0131
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351627.Csac_1114
Sequence length 179
Comment (Caldicellulosiruptor saccharolyticus DSM 8903)
Sequence
MSLELDYQTIVQFLSEQKLAYFAKNRKAFEKGIDLARKIKKENIQYDQEENAIFAKVEDG
KNEYWVFIDFALPLYMSQDFFGNIEIENIIITAACSCSLENITFESEEEIDIEDFVQSED
FCRHIIAVLKSFADGKYILNSLNKMQETLSQMLEQKLNEAIEKEKTKKLSHLPVYFKQF
Download sequence
Identical sequences A4XII9
351627.Csac_1114 gi|146296144|ref|YP_001179915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]