SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351745.Sputw3181_1677 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351745.Sputw3181_1677
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.84e-28
Family Sfri0576-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 351745.Sputw3181_1677
Sequence length 125
Comment (Shewanella W3-18-1)
Sequence
MLTISSSDADNIITVIASGWINHLDIESQLLPSIEAKLQDHATIRLWYEFSSEFEGISVG
ALWDDAMLSLFHLSDFSRVVMIADMKKLDAMVNALAFMLPCPVKIFAMNERDRARVWLDE
VVAIE
Download sequence
Identical sequences WP_011789012.1.65999 351745.Sputw3181_1677 gi|120598494|ref|YP_963068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]