SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351746.Pput_0091 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351746.Pput_0091
Domain Number 1 Region: 424-517
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.1e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351746.Pput_0091
Sequence length 521
Comment (Pseudomonas putida F1)
Sequence
MHRLSLLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYALIAGLPAEYGLYAAIV
PVLIACLWGSSWHLICGPTAAISIVLYASISPLAVAGSADYITLVLLLTFLGGLFQLLLG
LLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMALPSQATALKTVQDLASHAGEV
DLPSLLLGLATVVIGVAFKLWRPRWPSLLISLILVSLLAWLLPGFFGHVPRVAAFTGQLP
PFSPLPLLDVELMLRLLPSAVAVGMLGLVTSLSIARSLSARSEQLIDPDQEIRAQGLSNI
AGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFSALWVALFAVTGAGLIAHLPIPAMAGS
ILLICWGLVDHRGIRALFRVSRSEFLVMALTAAATLLLELQTAIYAGVLASLFFYLKRTS
RPRIQQSREGDADVLRVGGSIFFGAAHYLQVRLQRCQGPHVVIDARQVNFIDYSGVDMLH
REARRLRRLGGSLTLHRARPQVIEELQKLEGVELCPIRFEE
Download sequence
Identical sequences A5VWK6
gi|148545348|ref|YP_001265450.1| WP_011953127.1.1079 WP_011953127.1.35996 351746.Pput_0091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]