SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351746.Pput_0160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  351746.Pput_0160
Domain Number - Region: 18-90
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000432
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351746.Pput_0160
Sequence length 377
Comment (Pseudomonas putida F1)
Sequence
MEPMTTPSATLDTSCQPACLRITGDWTLAHYANLKRESERLRTQCAANTIADLSQLGRLD
TAGASLLAELLGSERLSRCTHALPEASQALLKNVYCSVQDYCIPVKEPERNVLLLLLERI
GCAVGTLWQDSMQLLGFVGVILETLLRRAFQPHRWRFTPVVAHIEQTGLDAAPIVALLTF
LVGAVVAFLGATVLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMK
ANEEIDAIRTLGLNPMELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALTLDISPAM
FLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFV
VIVLDAVAALFFMEMGW
Download sequence
Identical sequences A0A2K4LRN2 A5VWS5 I3UVT6
gi|395446469|ref|YP_006386722.1| WP_011953163.1.100978 WP_011953163.1.1079 WP_011953163.1.25319 WP_011953163.1.35996 WP_011953163.1.5613 WP_011953163.1.60844 WP_011953163.1.74642 WP_011953163.1.96951 gi|148545417|ref|YP_001265519.1| 351746.Pput_0160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]