SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351746.Pput_3576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351746.Pput_3576
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000981
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351746.Pput_3576
Sequence length 160
Comment (Pseudomonas putida F1)
Sequence
MSTGRIQFAEQSGTFVLKFVGEVRLTLCSALDATIEKIFTALNFSAIVIDLTETESIDST
TLGLLAKLSILSRQKVGLLPTVVTTNPDISRLLQSMGFDQVFNIVDRPIPCTDCLTDLPS
QDQNEEVVRSKVLEAHKILMGLNDSNREAFHDLVNALERG
Download sequence
Identical sequences A0A168X0C7 A0A173HCU1 A0A1Y5L0G4 A0A2I0CA84 A0A2K4LFN9 A5W6E0 I3UPZ1 I7B6Z8
351746.Pput_3576 gi|397694009|ref|YP_006531890.1| gi|395444424|ref|YP_006384677.1| gi|148548782|ref|YP_001268884.1| WP_003248823.1.100978 WP_003248823.1.1079 WP_003248823.1.11138 WP_003248823.1.25319 WP_003248823.1.33269 WP_003248823.1.33725 WP_003248823.1.35996 WP_003248823.1.44137 WP_003248823.1.45427 WP_003248823.1.5613 WP_003248823.1.60844 WP_003248823.1.74642 WP_003248823.1.75189 WP_003248823.1.78345 WP_003248823.1.89748 WP_003248823.1.96951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]