SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351746.Pput_4711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351746.Pput_4711
Domain Number 1 Region: 82-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000085
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351746.Pput_4711
Sequence length 145
Comment (Pseudomonas putida F1)
Sequence
MEMQWWIWLVFGIALILLELVLPTFFILWFGIGAVLVSLISLAAPSLQLDMQVLLWVLLS
SATTVLWFKVFRRKQPDVRWTADSVIGEVGLLTAPVSEFQKGRVRFQKPILGNEEWTCIA
DGQIAAGERVRLTAIEGNTARVIRA
Download sequence
Identical sequences A0A2K4LTL9 A5W9M1 I3UTJ2
351746.Pput_4711 gi|395445675|ref|YP_006385928.1| gi|148549913|ref|YP_001270015.1| WP_012053829.1.100978 WP_012053829.1.1079 WP_012053829.1.35996 WP_012053829.1.74642 WP_012053829.1.96951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]