SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 355276.LBL_1248 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355276.LBL_1248
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 3.53e-21
Family Ribosomal protein L9 C-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000000314
Family Ribosomal protein L9 N-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 355276.LBL_1248
Sequence length 149
Comment (Leptospira borgpetersenii serovar Hardjo-bovis L550)
Sequence
MRVILQKDVINLGDAGDLREVADGYARNFLFPKRLAVRANEGNTKAAFHQKKLGELKKEK
RKKAMEAVATNLNGKEYDILVKTGGGEKLFGAVTPIDVASILKKNGFELDKRKIEIAEPI
RNLGSYKIKIRLAEGIQPVITLHVKKEEE
Download sequence
Identical sequences Q04TH0 Q052J9
355276.LBL_1248 355277.LBJ_1196 gi|116330840|ref|YP_800558.1| WP_011669981.1.14 WP_011669981.1.30409 WP_011669981.1.38848 WP_011669981.1.421 WP_011669981.1.48790 WP_011669981.1.51494 WP_011669981.1.51921 WP_011669981.1.55252 WP_011669981.1.75198 WP_011669981.1.75262 WP_011669981.1.76100 WP_011669981.1.87468 WP_011669981.1.95176 gi|116327959|ref|YP_797679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]