SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355276.LBL_1350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  355276.LBL_1350
Domain Number - Region: 105-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0034
Family NfeD domain-like 0.01
Further Details:      
 
Domain Number - Region: 17-86
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0217
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 355276.LBL_1350
Sequence length 154
Comment (Leptospira borgpetersenii serovar Hardjo-bovis L550)
Sequence
MPDFLSNLTATIWIGGGILLILAEFFTPGTFIAFLGTSGIITGIVVYFFDISLGWQLGLW
ASLSIFLIYVGSTAIRKIFPAQMERSIPENDQIGKLVFVVKDVLVQRKGGRILFQGVEWD
AISEKARIPQGSKARILSRDNLTFLVEPLELPEE
Download sequence
Identical sequences M6CDN4
gi|116328055|ref|YP_797775.1| WP_011670059.1.14 WP_011670059.1.30409 WP_011670059.1.38848 WP_011670059.1.421 WP_011670059.1.48790 WP_011670059.1.51921 WP_011670059.1.55252 WP_011670059.1.75262 355276.LBL_1350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]