SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355276.LBL_2243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355276.LBL_2243
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.3e-28
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 355276.LBL_2243
Sequence length 111
Comment (Leptospira borgpetersenii serovar Hardjo-bovis L550)
Sequence
MEITRRESGNIVILDINGEIDLYNAPEIKDVIAKLIEEQKYYTIINLEKVSYIDSSGIGA
LISSLSNLKKYQGGLKIINVSGSVRKVFELTKLTSFFEIFDNEAEAVSAFK
Download sequence
Identical sequences A0A0E2BLP1 A0A0E2E9I7 A0A0G8BGV7 A0A0M1YW78 A0A1D7UYT9 A0A1V2E9K5 K6HBP6 K8Y4E3 M5UQY0 M6BGF3 M6JFS7 M6UPY5 M6V9C7 M6VRK5 M6WHS7 M6YZ41 Q04UC5
gi|116328859|ref|YP_798579.1| 355276.LBL_2243 355277.LBJ_0839 gi|116330535|ref|YP_800253.1| WP_002745051.1.102048 WP_002745051.1.10732 WP_002745051.1.10978 WP_002745051.1.13484 WP_002745051.1.14 WP_002745051.1.18401 WP_002745051.1.18456 WP_002745051.1.19286 WP_002745051.1.20664 WP_002745051.1.21210 WP_002745051.1.24014 WP_002745051.1.24606 WP_002745051.1.28466 WP_002745051.1.29418 WP_002745051.1.30409 WP_002745051.1.33639 WP_002745051.1.3512 WP_002745051.1.38540 WP_002745051.1.38848 WP_002745051.1.41926 WP_002745051.1.421 WP_002745051.1.4226 WP_002745051.1.44299 WP_002745051.1.4626 WP_002745051.1.48790 WP_002745051.1.51494 WP_002745051.1.51921 WP_002745051.1.55252 WP_002745051.1.57426 WP_002745051.1.58894 WP_002745051.1.61177 WP_002745051.1.6202 WP_002745051.1.62320 WP_002745051.1.62347 WP_002745051.1.63257 WP_002745051.1.67782 WP_002745051.1.67987 WP_002745051.1.68471 WP_002745051.1.68538 WP_002745051.1.69976 WP_002745051.1.70806 WP_002745051.1.75198 WP_002745051.1.75262 WP_002745051.1.76100 WP_002745051.1.79523 WP_002745051.1.80262 WP_002745051.1.80937 WP_002745051.1.83002 WP_002745051.1.84537 WP_002745051.1.84710 WP_002745051.1.86625 WP_002745051.1.86790 WP_002745051.1.87468 WP_002745051.1.89633 WP_002745051.1.90021 WP_002745051.1.9422 WP_002745051.1.95176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]