SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355276.LBL_4054 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355276.LBL_4054
Domain Number 1 Region: 11-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.82e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 355276.LBL_4054
Sequence length 113
Comment (Leptospira borgpetersenii serovar Hardjo-bovis L550)
Sequence
MSQLNIKKKEISSEIFVYILDGRLDENSFTDFKSKVIDPPHPKAVILNLSELKYISSSGI
RSIFELRYKLLNDGKKLFLTEASDKIIQIFNLLGLWKTFTHFITETEAIAAAK
Download sequence
Identical sequences M6C0R5 Q04NR5
gi|116329607|ref|YP_799326.1| gi|116332496|ref|YP_802213.1| WP_011671279.1.14 WP_011671279.1.30409 WP_011671279.1.38848 WP_011671279.1.421 WP_011671279.1.48790 WP_011671279.1.51921 WP_011671279.1.55252 WP_011671279.1.75262 WP_011671279.1.87468 WP_011671279.1.95176 355276.LBL_4054 355277.LBJ_4054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]