SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355276.LBL_4070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  355276.LBL_4070
Domain Number - Region: 22-117
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00392
Family Anti-sigma factor antagonist SpoIIaa 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 355276.LBL_4070
Sequence length 137
Comment (Leptospira borgpetersenii serovar Hardjo-bovis L550)
Sequence
MSQAVTIEHELKELQVNTVRYKLLVIEFAGMVNHETLRGIPAKLSSIFYEMEGMLVLDIR
KVTNLNSEFVRAFTGILHIISERFTRYFIMTADQKIYNWIMNYNKLREVKPVTDFDELKE
ALELDKMAPLLGLKNVG
Download sequence
Identical sequences M6BP05
WP_011671293.1.75262 gi|116329621|ref|YP_799340.1| 355276.LBL_4070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]