SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355276.LBL_4257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  355276.LBL_4257
Domain Number - Region: 21-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000275
Family Anti-sigma factor antagonist SpoIIaa 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 355276.LBL_4257
Sequence length 111
Comment (Leptospira borgpetersenii serovar Hardjo-bovis L550)
Sequence
MNFVNPIQKYERFEIRRNRQSTEVIPLVVSFDEIAFEELKSVLALIFYQFNLHVKINLSR
VKILPLPVAMKLLSFGFDLRLKSRTLVIEGASASFKKLIRFYRMDKAILVL
Download sequence
Identical sequences A0A0S2IXU4 M3HIV6 M6BWC7 M6ESI1 Q04N99
WP_002724906.1.100408 WP_002724906.1.11109 WP_002724906.1.11815 WP_002724906.1.14 WP_002724906.1.15257 WP_002724906.1.15764 WP_002724906.1.16921 WP_002724906.1.18256 WP_002724906.1.27770 WP_002724906.1.30409 WP_002724906.1.32346 WP_002724906.1.38848 WP_002724906.1.39602 WP_002724906.1.421 WP_002724906.1.43452 WP_002724906.1.46921 WP_002724906.1.47267 WP_002724906.1.48790 WP_002724906.1.51225 WP_002724906.1.51494 WP_002724906.1.51771 WP_002724906.1.51921 WP_002724906.1.53464 WP_002724906.1.55252 WP_002724906.1.56917 WP_002724906.1.61387 WP_002724906.1.67310 WP_002724906.1.69722 WP_002724906.1.75198 WP_002724906.1.75262 WP_002724906.1.76100 WP_002724906.1.78595 WP_002724906.1.84953 WP_002724906.1.87468 WP_002724906.1.9319 WP_002724906.1.93348 WP_002724906.1.95176 355276.LBL_4257 355277.LBJ_4243 gi|116329780|ref|YP_799499.1| gi|116332662|ref|YP_802379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]