SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355277.LBJ_1811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355277.LBJ_1811
Domain Number 1 Region: 23-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000135
Family Anti-sigma factor antagonist SpoIIaa 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 355277.LBJ_1811
Sequence length 124
Comment (Leptospira borgpetersenii serovar Hardjo-bovis JB197)
Sequence
MPFLLYTDLQEVPSESSGISYSKVTIEGELTIYEALEFKEKLDSVFGNCFSFLEIDLFKL
QKIDTSCLQILLSFKKEAQRINADVRFVNHSHGVTKLIDFYGLSWLLNDDSKFSKLVQFE
VGKD
Download sequence
Identical sequences Q04RX4
355277.LBJ_1811 WP_011671841.1.87468 WP_011671841.1.95176 gi|116331386|ref|YP_801104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]