SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355277.LBJ_1934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  355277.LBJ_1934
Domain Number - Region: 105-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0034
Family NfeD domain-like 0.01
Further Details:      
 
Domain Number - Region: 17-85
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0196
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 355277.LBJ_1934
Sequence length 154
Comment (Leptospira borgpetersenii serovar Hardjo-bovis JB197)
Sequence
MPDFLSNLTVTIWIGGGILLILAEFFTPGTFIAFLGTSGIITGIVVYFFDISLGWQLGLW
ASLSIFLIYVGSTAIRKIFPAQMERSIPENDQIGKLVFVVKDVLVQRKGGRILFQGVEWD
AISEKARIPQGSKARILSRDNLTFLVEPLELPEE
Download sequence
Identical sequences Q04RL8
gi|116331492|ref|YP_801210.1| WP_011671866.1.87468 WP_011671866.1.95176 355277.LBJ_1934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]