SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355277.LBJ_2748 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355277.LBJ_2748
Domain Number 1 Region: 19-95
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 355277.LBJ_2748
Sequence length 96
Comment (Leptospira borgpetersenii serovar Hardjo-bovis JB197)
Sequence
MSETPETIEITPDLTTLFNDYYTFRRILMDAIDKKPKSIVLNLGDIPMMNSISISSLVWF
LKNARSEGISCTISAIHPDLLNTFEILSLKEYLDIR
Download sequence
Identical sequences M6BQ29 Q04PL4
gi|116327147|ref|YP_796867.1| WP_011669363.1.14 WP_011669363.1.30409 WP_011669363.1.38848 WP_011669363.1.421 WP_011669363.1.48790 WP_011669363.1.51494 WP_011669363.1.51921 WP_011669363.1.55252 WP_011669363.1.75198 WP_011669363.1.75262 WP_011669363.1.76100 WP_011669363.1.87468 WP_011669363.1.95176 355276.LBL_0323 355277.LBJ_2748 gi|116332196|ref|YP_801914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]