SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355277.LBJ_4175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  355277.LBJ_4175
Domain Number - Region: 4-70
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00053
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 
Domain Number - Region: 104-139
Classification Level Classification E-value
Superfamily RING/U-box 0.00544
Family RING finger domain, C3HC4 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 355277.LBJ_4175
Sequence length 151
Comment (Leptospira borgpetersenii serovar Hardjo-bovis JB197)
Sequence
MKEIIINLQGDLDFKLGEALLSKLEELSEFPRKILLDASGLKSTTPEGVSLLNRLPKRFP
ESKFAICSVPIEISAQNEKEIPVFKDRESAKSHLIATDSSAFSENTPTLINCPICFHLLK
IQNFGNHSCPLCHAKFFVTKDLRASAFERLL
Download sequence
Identical sequences M6BP22 Q04NF8
WP_011671365.1.14 WP_011671365.1.30409 WP_011671365.1.38848 WP_011671365.1.421 WP_011671365.1.48790 WP_011671365.1.51494 WP_011671365.1.51921 WP_011671365.1.55252 WP_011671365.1.75198 WP_011671365.1.75262 WP_011671365.1.76100 WP_011671365.1.87468 WP_011671365.1.95176 gi|116329719|ref|YP_799438.1| 355276.LBL_4190 355277.LBJ_4175 gi|116332603|ref|YP_802320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]