SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355278.LBF_1154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355278.LBF_1154
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-25
Family Anti-sigma factor antagonist SpoIIaa 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 355278.LBF_1154
Sequence length 110
Comment (Leptospira biflexa serovar Patoc Patoc 1 Ames )
Sequence
MLKHEVKDGKLVVYLEGRLDVSVANEVEEGLTELIDSLGHRKVLLNMKDVEYMSSSGFRA
CISTLRKLNSKEGFLKISNIKPAVKRIFDVIELTSLFDIYDSEDAALKSF
Download sequence
Identical sequences B0SNN2 Q5MI56
355278.LBF_1154 456481.LEPBI_I1197 gi|183220593|ref|YP_001838589.1| gi|189910701|ref|YP_001962256.1| WP_012388194.1.33202 WP_012388194.1.95533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]