SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355278.LBF_1267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355278.LBF_1267
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 355278.LBF_1267
Sequence length 102
Comment (Leptospira biflexa serovar Patoc Patoc 1 Ames )
Sequence
MFQYEVKRENEKVIIILNGSLSLRDTPKLKTEIKELIDSDSIKELVLDFKYLSYLDSSGI
GILLHTYSWTKEKNKKVKMVHVSNEIKTIFSVANLLEMFEIE
Download sequence
Identical sequences B0SPA7
WP_012388312.1.33202 WP_012388312.1.95533 355278.LBF_1267 456481.LEPBI_I1321 gi|189910812|ref|YP_001962367.1| gi|183220711|ref|YP_001838707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]