SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355278.LBF_1533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355278.LBF_1533
Domain Number 1 Region: 8-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 355278.LBF_1533
Sequence length 123
Comment (Leptospira biflexa serovar Patoc Patoc 1 Ames )
Sequence
MEPNQTIVSSNEGTSIQWTGYLTVPFIKEWYDLANHWDFPKGKRTKLDLNGIERIDSAGI
QFLIFIKKRSHSKHQVLELTNHSLPVLKVLDLLGLVSFFGDRIKVKKEHSNEVEFRYGTR
KVS
Download sequence
Identical sequences B0SQZ0
WP_012388570.1.33202 WP_012388570.1.95533 355278.LBF_1533 456481.LEPBI_I1584 gi|183220971|ref|YP_001838967.1| gi|189911066|ref|YP_001962621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]