SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355278.LBF_1661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355278.LBF_1661
Domain Number 1 Region: 9-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 355278.LBF_1661
Sequence length 118
Comment (Leptospira biflexa serovar Patoc Patoc 1 Ames )
Sequence
MSLDDLVVSTEKIDTVYVTKLQGNLNNFTAEKCIKSVTNSLKHGSVILDLEELNMVTTQG
IIAFKTLNEEAFLQKHKIILINLPLSVRQAFLMAGVRNLFPIANNEEAAFKMASRPSR
Download sequence
Identical sequences B0SRM4
gi|189911191|ref|YP_001962746.1| WP_012388697.1.33202 WP_012388697.1.95533 355278.LBF_1661 456481.LEPBI_I1713 gi|183221099|ref|YP_001839095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]