SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 355278.LBF_2850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355278.LBF_2850
Domain Number 1 Region: 13-130
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-20
Family cAMP-binding domain 0.019
Further Details:      
 
Domain Number 2 Region: 140-206
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000262
Family CAP C-terminal domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 355278.LBF_2850
Sequence length 208
Comment (Leptospira biflexa serovar Patoc Patoc 1 Ames )
Sequence
MIIKYLTKQSPESLLKAFEACKELTFDKDEFLFHSGDEVTHMDLLVNGDLQVFKYDGNMN
EVTLTFFRPVSIIAEWAVIQGIPYPASARFTKKSTILRMPLTEVQSRLNSSIALNHILMH
SLMNKIDTLNLAINRGLTMDAMQRVAHFLFYGTPDSLALKQTQMASLLYLRPETFSRILK
QLKDQGLVDTQRGEITILDKEGLLKILA
Download sequence
Identical sequences B0SP06
355278.LBF_2850 456481.LEPBI_I2950 gi|189912348|ref|YP_001963903.1| gi|183222298|ref|YP_001840294.1| WP_012389876.1.33202 WP_012389876.1.95533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]