SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357348.BURPS1106A_0752 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357348.BURPS1106A_0752
Domain Number 1 Region: 95-361
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.68e-78
Family D-glucarate dehydratase-like 0.0000608
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.63e-33
Family Enolase N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357348.BURPS1106A_0752
Sequence length 382
Comment (Burkholderia pseudomallei 1106a)
Sequence
MKITRLETFVVPPRWLFLKIETDAGIVGWGEPIVEGRAHTVEAAVHELADYLVGQDPLRI
EDHWQVMYRAGFYRGGPITMSAIAGIDQALWDIKGKHHGAPVHALLGGPVRERIKVYSWI
GGDRPSDVANNARAVVERGFQAVKMNGSEELQIVDTFDKVDKVIANVAAVRDAVGPYVGI
GVDFHGRVHKPMAKVLARELDPYKLMFIEEPVLSENAEALRDIANQTSTPIALGERLYSR
WDFKRILEGGYVDIVQPDASHAGGITECRKIATLAESYDVALALHCPLGPIALAACLQLD
AVSYNAFIQEQSLGIHYNQGSDLLDYLRNPDVFRYADGFVAIPQGPGLGIDVDEDKVREM
AKTGHRWRNPVWRHADGSVAEW
Download sequence
Identical sequences A0A095LNU1 A0A0E1SC47 A0A0E1U5B7 A0A0E1UJR0 A0A0F6GEY3 A0A0F6L8N0 A0A0H3HR95 A0A2K3F6V8 A0A2K3G7H2 A0A2K3HAU1 A0A2K3I3F5 A3NRR3 C4KQG3
WP_004522775.1.10047 WP_004522775.1.100583 WP_004522775.1.100825 WP_004522775.1.101060 WP_004522775.1.101307 WP_004522775.1.101783 WP_004522775.1.10290 WP_004522775.1.10553 WP_004522775.1.10633 WP_004522775.1.10746 WP_004522775.1.10907 WP_004522775.1.1098 WP_004522775.1.11046 WP_004522775.1.11072 WP_004522775.1.11160 WP_004522775.1.11268 WP_004522775.1.11404 WP_004522775.1.11996 WP_004522775.1.11998 WP_004522775.1.1266 WP_004522775.1.13198 WP_004522775.1.13309 WP_004522775.1.13504 WP_004522775.1.13639 WP_004522775.1.13950 WP_004522775.1.14356 WP_004522775.1.14539 WP_004522775.1.14557 WP_004522775.1.1465 WP_004522775.1.15696 WP_004522775.1.16113 WP_004522775.1.16249 WP_004522775.1.16540 WP_004522775.1.16561 WP_004522775.1.16689 WP_004522775.1.17067 WP_004522775.1.17473 WP_004522775.1.17748 WP_004522775.1.17786 WP_004522775.1.18058 WP_004522775.1.18396 WP_004522775.1.18471 WP_004522775.1.18549 WP_004522775.1.18631 WP_004522775.1.18669 WP_004522775.1.18868 WP_004522775.1.19401 WP_004522775.1.19486 WP_004522775.1.19540 WP_004522775.1.19629 WP_004522775.1.1976 WP_004522775.1.19815 WP_004522775.1.19842 WP_004522775.1.20673 WP_004522775.1.21291 WP_004522775.1.21304 WP_004522775.1.21409 WP_004522775.1.21653 WP_004522775.1.21809 WP_004522775.1.22299 WP_004522775.1.2261 WP_004522775.1.22779 WP_004522775.1.23009 WP_004522775.1.23086 WP_004522775.1.23104 WP_004522775.1.2317 WP_004522775.1.23852 WP_004522775.1.24020 WP_004522775.1.2404 WP_004522775.1.24134 WP_004522775.1.24372 WP_004522775.1.24454 WP_004522775.1.24513 WP_004522775.1.2462 WP_004522775.1.25102 WP_004522775.1.25138 WP_004522775.1.25265 WP_004522775.1.25412 WP_004522775.1.25728 WP_004522775.1.26054 WP_004522775.1.26535 WP_004522775.1.26565 WP_004522775.1.26633 WP_004522775.1.26645 WP_004522775.1.26838 WP_004522775.1.27069 WP_004522775.1.27146 WP_004522775.1.27363 WP_004522775.1.27390 WP_004522775.1.27420 WP_004522775.1.27441 WP_004522775.1.27810 WP_004522775.1.28066 WP_004522775.1.28187 WP_004522775.1.28619 WP_004522775.1.28632 WP_004522775.1.29161 WP_004522775.1.29178 WP_004522775.1.29335 WP_004522775.1.29405 WP_004522775.1.29853 WP_004522775.1.29878 WP_004522775.1.29887 WP_004522775.1.29948 WP_004522775.1.30671 WP_004522775.1.3069 WP_004522775.1.30729 WP_004522775.1.30937 WP_004522775.1.30966 WP_004522775.1.31343 WP_004522775.1.31723 WP_004522775.1.324 WP_004522775.1.32951 WP_004522775.1.33087 WP_004522775.1.33130 WP_004522775.1.33157 WP_004522775.1.33158 WP_004522775.1.33165 WP_004522775.1.33493 WP_004522775.1.35052 WP_004522775.1.35141 WP_004522775.1.35227 WP_004522775.1.35825 WP_004522775.1.36174 WP_004522775.1.36527 WP_004522775.1.36662 WP_004522775.1.36944 WP_004522775.1.37446 WP_004522775.1.37517 WP_004522775.1.37519 WP_004522775.1.37535 WP_004522775.1.37627 WP_004522775.1.37690 WP_004522775.1.37702 WP_004522775.1.37806 WP_004522775.1.37934 WP_004522775.1.37994 WP_004522775.1.38115 WP_004522775.1.38490 WP_004522775.1.38683 WP_004522775.1.3872 WP_004522775.1.39162 WP_004522775.1.39179 WP_004522775.1.3947 WP_004522775.1.39757 WP_004522775.1.39898 WP_004522775.1.40021 WP_004522775.1.40045 WP_004522775.1.40235 WP_004522775.1.40390 WP_004522775.1.40426 WP_004522775.1.40448 WP_004522775.1.42408 WP_004522775.1.42496 WP_004522775.1.42800 WP_004522775.1.43136 WP_004522775.1.43542 WP_004522775.1.43581 WP_004522775.1.43727 WP_004522775.1.43786 WP_004522775.1.44179 WP_004522775.1.44352 WP_004522775.1.45348 WP_004522775.1.45890 WP_004522775.1.46575 WP_004522775.1.46757 WP_004522775.1.46829 WP_004522775.1.4693 WP_004522775.1.46969 WP_004522775.1.47149 WP_004522775.1.4718 WP_004522775.1.47564 WP_004522775.1.48165 WP_004522775.1.48464 WP_004522775.1.50336 WP_004522775.1.50401 WP_004522775.1.50636 WP_004522775.1.50788 WP_004522775.1.5105 WP_004522775.1.51666 WP_004522775.1.51874 WP_004522775.1.51891 WP_004522775.1.51902 WP_004522775.1.52229 WP_004522775.1.52365 WP_004522775.1.52451 WP_004522775.1.52521 WP_004522775.1.52643 WP_004522775.1.52760 WP_004522775.1.5292 WP_004522775.1.53034 WP_004522775.1.53048 WP_004522775.1.53103 WP_004522775.1.53132 WP_004522775.1.53282 WP_004522775.1.5338 WP_004522775.1.53386 WP_004522775.1.53506 WP_004522775.1.53578 WP_004522775.1.54016 WP_004522775.1.5413 WP_004522775.1.54804 WP_004522775.1.54859 WP_004522775.1.55415 WP_004522775.1.55691 WP_004522775.1.55755 WP_004522775.1.55996 WP_004522775.1.5608 WP_004522775.1.56248 WP_004522775.1.56451 WP_004522775.1.56458 WP_004522775.1.56591 WP_004522775.1.56949 WP_004522775.1.56993 WP_004522775.1.57096 WP_004522775.1.57247 WP_004522775.1.5734 WP_004522775.1.57359 WP_004522775.1.58105 WP_004522775.1.58190 WP_004522775.1.58362 WP_004522775.1.58390 WP_004522775.1.58509 WP_004522775.1.5883 WP_004522775.1.59255 WP_004522775.1.59422 WP_004522775.1.59519 WP_004522775.1.59536 WP_004522775.1.59549 WP_004522775.1.60769 WP_004522775.1.60810 WP_004522775.1.60833 WP_004522775.1.60836 WP_004522775.1.60969 WP_004522775.1.61084 WP_004522775.1.61455 WP_004522775.1.61685 WP_004522775.1.61900 WP_004522775.1.62103 WP_004522775.1.62183 WP_004522775.1.62774 WP_004522775.1.63097 WP_004522775.1.63261 WP_004522775.1.63361 WP_004522775.1.63379 WP_004522775.1.63439 WP_004522775.1.63505 WP_004522775.1.63661 WP_004522775.1.63719 WP_004522775.1.64096 WP_004522775.1.64166 WP_004522775.1.64383 WP_004522775.1.64683 WP_004522775.1.64892 WP_004522775.1.65093 WP_004522775.1.65832 WP_004522775.1.66257 WP_004522775.1.66321 WP_004522775.1.66465 WP_004522775.1.67013 WP_004522775.1.67182 WP_004522775.1.67229 WP_004522775.1.67860 WP_004522775.1.67909 WP_004522775.1.67978 WP_004522775.1.68922 WP_004522775.1.69081 WP_004522775.1.69094 WP_004522775.1.69106 WP_004522775.1.69169 WP_004522775.1.69354 WP_004522775.1.70016 WP_004522775.1.70278 WP_004522775.1.70280 WP_004522775.1.70735 WP_004522775.1.71392 WP_004522775.1.71901 WP_004522775.1.72015 WP_004522775.1.72083 WP_004522775.1.72817 WP_004522775.1.73317 WP_004522775.1.73906 WP_004522775.1.74177 WP_004522775.1.74425 WP_004522775.1.7450 WP_004522775.1.75027 WP_004522775.1.75075 WP_004522775.1.75276 WP_004522775.1.75519 WP_004522775.1.75677 WP_004522775.1.75708 WP_004522775.1.75711 WP_004522775.1.75776 WP_004522775.1.76432 WP_004522775.1.76522 WP_004522775.1.76575 WP_004522775.1.766 WP_004522775.1.7703 WP_004522775.1.77287 WP_004522775.1.77689 WP_004522775.1.78827 WP_004522775.1.795 WP_004522775.1.79689 WP_004522775.1.80098 WP_004522775.1.80433 WP_004522775.1.81511 WP_004522775.1.81543 WP_004522775.1.82323 WP_004522775.1.82394 WP_004522775.1.82575 WP_004522775.1.82694 WP_004522775.1.82915 WP_004522775.1.83357 WP_004522775.1.83543 WP_004522775.1.83567 WP_004522775.1.83688 WP_004522775.1.8388 WP_004522775.1.8390 WP_004522775.1.8395 WP_004522775.1.83967 WP_004522775.1.84375 WP_004522775.1.84866 WP_004522775.1.85170 WP_004522775.1.85412 WP_004522775.1.85443 WP_004522775.1.85467 WP_004522775.1.85490 WP_004522775.1.85584 WP_004522775.1.85641 WP_004522775.1.85645 WP_004522775.1.8585 WP_004522775.1.86295 WP_004522775.1.86872 WP_004522775.1.8697 WP_004522775.1.87114 WP_004522775.1.87278 WP_004522775.1.87553 WP_004522775.1.87811 WP_004522775.1.88003 WP_004522775.1.88168 WP_004522775.1.88237 WP_004522775.1.88322 WP_004522775.1.88682 WP_004522775.1.88920 WP_004522775.1.89093 WP_004522775.1.8912 WP_004522775.1.90079 WP_004522775.1.9079 WP_004522775.1.91025 WP_004522775.1.91198 WP_004522775.1.91700 WP_004522775.1.91709 WP_004522775.1.91823 WP_004522775.1.92095 WP_004522775.1.92367 WP_004522775.1.92507 WP_004522775.1.9280 WP_004522775.1.92904 WP_004522775.1.93845 WP_004522775.1.94023 WP_004522775.1.94050 WP_004522775.1.94117 WP_004522775.1.94286 WP_004522775.1.94403 WP_004522775.1.94498 WP_004522775.1.9479 WP_004522775.1.95339 WP_004522775.1.9537 WP_004522775.1.95420 WP_004522775.1.95672 WP_004522775.1.96381 WP_004522775.1.97148 WP_004522775.1.98218 WP_004522775.1.98491 WP_004522775.1.98547 WP_004522775.1.98768 WP_004522775.1.98944 WP_004522775.1.99233 WP_004522775.1.9962 WP_004522775.1.99741 WP_004522775.1.9983 WP_004522775.1.99890 gi|386862859|ref|YP_006275808.1| gi|556574933|ref|YP_008743383.1| gi|526471732|ref|YP_008341463.1| 357348.BURPS1106A_0752 536230.GBP346_A0670 gi|237810944|ref|YP_002895395.1| gi|403517404|ref|YP_006651537.1| gi|126453639|ref|YP_001065034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]