SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357348.BURPS1106A_A0824 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357348.BURPS1106A_A0824
Domain Number 1 Region: 45-231
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.02e-23
Family Biotin dependent carboxylase carboxyltransferase domain 0.034
Further Details:      
 
Domain Number 2 Region: 450-488
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000144
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357348.BURPS1106A_A0824
Sequence length 501
Comment (Burkholderia pseudomallei 1106a)
Sequence
MPRSSPRPPPARGKLPARLARAAVLIGLLLACAAVAGAAAAARAPVVVIPVAGAIGPASA
DFVVRGLERAAREHAPLAIVQLDTPGGLDTSMRQIIKAIVASGVPVAAFVAPGGARAASA
GTYIVYASHVAAMAPGTNLGAASPVQLGIGGQAPAGGRREPAGAPGAAGAGATDTESIET
RKALHDAAAYIRGLAQLRGRNAEWAERAVREAVSLPANDALAQHVVDLLANDPADLAAKL
DGRTIVTATGAHRLDTAQAPLETLEPDWRSRLLATIADPSVALVLVTLGMYGLFFEFANP
GFVLPGVAGAISLLVGLFALQLLPISYAGLALVLLGIAFLIAETFLPTFGALGVGGIVAF
AIGALMLIDTDVPGYGVPWPVIASLAAAGAILVFGVSGFALRARRRPVVTGAEAIVGSIG
EVLDDGLVPDQPPQIGPSADPGAPLAPSAAGWARVHGERWRVASATPIAAGRRVRVTGRN
GLTLTVAPLYDNVVPPRGEPP
Download sequence
Identical sequences A0A1W6FR11 A3P3F0
357348.BURPS1106A_A0824 gi|126456811|ref|YP_001074860.1| WP_004537327.1.10907 WP_004537327.1.12856 WP_004537327.1.13639 WP_004537327.1.16249 WP_004537327.1.16689 WP_004537327.1.27069 WP_004537327.1.29335 WP_004537327.1.29853 WP_004537327.1.33157 WP_004537327.1.33493 WP_004537327.1.36666 WP_004537327.1.37690 WP_004537327.1.38490 WP_004537327.1.3872 WP_004537327.1.39078 WP_004537327.1.39162 WP_004537327.1.39179 WP_004537327.1.39757 WP_004537327.1.42408 WP_004537327.1.43136 WP_004537327.1.43786 WP_004537327.1.46757 WP_004537327.1.48464 WP_004537327.1.52229 WP_004537327.1.52643 WP_004537327.1.53048 WP_004537327.1.54016 WP_004537327.1.54859 WP_004537327.1.5608 WP_004537327.1.57247 WP_004537327.1.59422 WP_004537327.1.60810 WP_004537327.1.61084 WP_004537327.1.64364 WP_004537327.1.67860 WP_004537327.1.70278 WP_004537327.1.71901 WP_004537327.1.72015 WP_004537327.1.72817 WP_004537327.1.74425 WP_004537327.1.75711 WP_004537327.1.76142 WP_004537327.1.766 WP_004537327.1.77689 WP_004537327.1.80433 WP_004537327.1.82394 WP_004537327.1.83357 WP_004537327.1.83543 WP_004537327.1.83688 WP_004537327.1.84026 WP_004537327.1.85412 WP_004537327.1.86806 WP_004537327.1.87278 WP_004537327.1.88237 WP_004537327.1.91025 WP_004537327.1.98547 WP_004537327.1.98768 WP_004537327.1.9962 gi|403522156|ref|YP_006657725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]