SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357804.Ping_1642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357804.Ping_1642
Domain Number 1 Region: 4-210
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.41e-26
Family Clp protease, ClpP subunit 0.031
Further Details:      
 
Domain Number 2 Region: 384-445
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000183
Family NfeD domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 357804.Ping_1642
Sequence length 455
Comment (Psychromonas ingrahamii 37)
Sequence
MNKWPIFWLLFLTFFCFTASAKEVWVIPVQGAIGPATSDYIEREFQLAQQQDISLMILKM
DTPGGLDSAMRSIIQNITSSTIPVATWVGPNGARAASAGTYILLASHIAAMANATNLGAA
TPVAIGISGPESSPSDENSPSSQKDAKNSEQVSAKTTLEKKVINDASAYIKGLAKLHGRN
EEWAEKAVREAASIDAQTALAGHVIDFIADNLEQVIEFANGREILLLGNKNKLSLDEVSL
IERVPDWRYSFLATITNPNIAYILMLIGIYGLILEFYSPGVGLPGVLGGICLVLAMYAMQ
MLPINYAGLAFILLGLLLLVAEAFSPSFGALGLGGIVSFILGSIFLMDSDLPEYQIAKPL
IMALALLSTTFILLMIALLLKIRRKTVTTGVDRLVGRLAIVKDDFDTGQGWVEIAGEIWH
ASSADSLLAGQKVRVKQVSGLNLIVCANEKNSLME
Download sequence
Identical sequences A1SVC0
gi|119945354|ref|YP_943034.1| 357804.Ping_1642 WP_011769995.1.40834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]