SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357804.Ping_1879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  357804.Ping_1879
Domain Number - Region: 110-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00379
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357804.Ping_1879
Sequence length 160
Comment (Psychromonas ingrahamii 37)
Sequence
MEYFLAHLAQVFIVSGLILLAIEVLVLGFSTFVFFFIGVGAIATGALIALGIIPATFLNS
LLVTAIISTVAALISWKPLKKMQNKVGSKHVNNDMIGHQFVLTEDLRIGKTITHRYSGIN
WQVKAKEPLSAGTNVKIIEIEVGLLTVEGVDSLSTHKKVL
Download sequence
Identical sequences A1SVZ0
gi|119945574|ref|YP_943254.1| WP_011770215.1.40834 357804.Ping_1879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]