SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357804.Ping_2050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357804.Ping_2050
Domain Number 1 Region: 455-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 357804.Ping_2050
Sequence length 571
Comment (Psychromonas ingrahamii 37)
Sequence
MLQPIYAVFYLENNVVLGNRFENINLKGDIFGGVTTAIISLPLALAFGVASGAGAEAGLW
GAIMVGFFAALFGGSTTLISEPTGPMTVIMTAVLTSMMAKYPETGMAMSFTVVMMAGAFQ
VILGTLKLGKYVTLMPYSVISGFMSGIGVILIILQLSPLLGHSAPAGGVIGTLSAIPDTL
VNMDFSELFLGLLTLAVLFYFPKKYRKYVPAQLVALVAVTLLSVFFFDSESIRRIGEIPA
GLPSLVLPHFNADMFTNMVLDALVLGTLGCIDTLLTAVIGDSLTRKEHDSDKELRGQGIA
NMISGLFGALPGAGATMGTVTNIHVGARSPVSGMVRALVLALVVLVAGGLTEPIPMAVLA
GIAIYVGLNILDWSFIQRAHKVSIQGMAIMYGVMLLTVFVDLIVAVGLGVFISNIIIIEK
LSREQARKVKAISDADENDVPLTDHERVLLDKAGGKVLFFYLSGPMIFSVSKAISRQHAS
ISDYQVMILDLSDVPMIDVTVGLALENAVKDAQDSNCEVLLLCPNRGTREQLKKFHILDL
IANANNYTHREQALQAALNHVATEKYQTTRS
Download sequence
Identical sequences A1SWE0
gi|119945724|ref|YP_943404.1| 357804.Ping_2050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]