SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_0350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_0350
Domain Number 1 Region: 250-356
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0034
Further Details:      
 
Weak hits

Sequence:  357808.RoseRS_0350
Domain Number - Region: 178-241
Classification Level Classification E-value
Superfamily OmpH-like 0.0615
Family OmpH-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_0350
Sequence length 385
Comment (Roseiflexus RS-1)
Sequence
MRDRFNAIMTTRATDVDVQRRALAVMQLIAAMLVANVLFLALGLLSSGAQSAFIPIASSI
CFIGAFVLARQGRASVAAWIVILAFLAGAMIAVTRTPPEQASNVGYFLTALIVIASLTLT
PGQLWLVTFGVVASFLATLALAHPGFWDMAPVRLHTMNSSVLLVVVGFVSYVGARLARRA
INEAHQARALAERMQAELAQANAQLETRVAERTTELSRTLAAQQALTAELQRSLAAQQEL
SQIILELSLPVIPVREGTVVVPLSGTIDSTRAAKLTESVLRVVEQRHIHTVILDITGVPI
VDTQVAQALVRTASAARLMGAETILVGIRPEVAQTLIGLGIHLGLRTAATLQEGLELPTR
DARRRNGGAVAPGRMKASYEDTSDR
Download sequence
Identical sequences A5UQ79
WP_011955139.1.23570 gi|148654527|ref|YP_001274732.1| 357808.RoseRS_0350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]