SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_1336 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_1336
Domain Number 1 Region: 379-445
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000942
Family NfeD domain-like 0.0038
Further Details:      
 
Domain Number 2 Region: 42-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.00000000000298
Family Biotin dependent carboxylase carboxyltransferase domain 0.039
Further Details:      
 
Weak hits

Sequence:  357808.RoseRS_1336
Domain Number - Region: 245-377
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00589
Family Glycerol-3-phosphate transporter 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_1336
Sequence length 464
Comment (Roseiflexus RS-1)
Sequence
MPAHCSPYQRSSMLVVALATALLLLILPDENATAQQSGGPLYAVEVNGIVTAPTIDYLRR
AVQIAEASSADALIISYSSTGGVLREVRVFAAEIAQARVPIVVFITPRGTQAGPAGALFV
TAAHVSALAPDTSFGSPFPLAQVDETLSQQTRDLLLDNVSAQMRKWNETRGRNADWIDRA
VREGVILNNQQAISLDPPAVDLVAADQRELLTLLEGRTVTLDDGRTVRISALGRTPTFIE
PTLFESLRLALADPTVAFALLVLGSMAIYLELNTPGVGLFAGAGLVLLLGAAAGFLVLPI
VWWGMTLVILGLVLIGAEFVAPTHGGLMITGLAMLGVGGGNLIDATQAPGAGVAWWALLI
VIGGIAATAAAGLALALRSRKRPAAIGTEALIGRLAQVRRRLDPRGMVFVEGALWQAISE
SEPVEVGDWVRVVAVHNLQLIVRPLESEEPAPQEAQPPSGGRVV
Download sequence
Identical sequences A5USY6
gi|148655484|ref|YP_001275689.1| WP_011956091.1.23570 357808.RoseRS_1336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]