SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_1935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_1935
Domain Number 1 Region: 310-415
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.43e-16
Family Anti-sigma factor antagonist SpoIIaa 0.006
Further Details:      
 
Domain Number 2 Region: 213-262
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000000222
Family HAMP domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_1935
Sequence length 421
Comment (Roseiflexus RS-1)
Sequence
MSWSLTRKTAVLAVGYLIILGVLAIDLIFTVIEIQNVANDLNQAIIDDVQTVAAINLAAQ
QFLTESYSYLQTRHPAEYEESAELLKQLEEATARMRTSEHISSLVLADIDQQHASIADEA
EALLRAAQRLYNRLPSETDALTDTQREAFYAEIELVEEQREAFTDQANAHFAGMGDVARQ
YIANDVTLTFADVVLALMAMVALTAGALWLIERRIVRPLRSITNVASRLAEGRLDGELPV
TSNDEIGMLQQTFNRMAATVQQQASDLELHYRQVTQARDALEIAHRQAVEQLTIIQQQQE
AIRELSVPVLPVSHDTLVMPLVGALDSTRLLQVQEQALERIAATRARRLLLDITGVPVVD
SHVAQGLIRVVQAARLLGSDVTLIGIRSEVAQSIVGLGISLSSIRTCSDLQSALAQKGGG
S
Download sequence
Identical sequences A5UUM0
gi|148656068|ref|YP_001276273.1| 357808.RoseRS_1935 WP_011956669.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]