SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_2416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_2416
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.48e-69
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000163
Further Details:      
 
Domain Number 2 Region: 189-324
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.1e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_2416
Sequence length 327
Comment (Roseiflexus RS-1)
Sequence
MPVMTFIEAIRSAMHDAMAADDRIIVLGEDVAVRGGVFLATEGLLARFGERRVIDMPIAE
CAIVGVAIGAALHGLLPIAEIQFADYIYPAIDQILNEAARLRYRSNGDWSCPIVVRAPFG
AGIHGALYHSQSVERLFTSTPGIKVVIPSTPADAKGLLIAAIHDPDPVIFFEHKQLYRSV
RGEAPEGIYHEPIGKAVVRRSGTDMSVFSYGLMVHYALTAAEQLAAEGIDAEVIDLRTLA
PLDRAAILASVEKTGRALIVHEDVLTGGIGGEIAAIIAEHAFEYLDAPVRRLASPDLFAT
PFADPLEDHFMLNPQKIAAAMRDLARY
Download sequence
Identical sequences A5UVZ0
WP_011957137.1.23570 gi|148656538|ref|YP_001276743.1| 357808.RoseRS_2416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]