SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_2635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_2635
Domain Number 1 Region: 245-347
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_2635
Sequence length 355
Comment (Roseiflexus RS-1)
Sequence
MLSTHDKMQTGTPDAAGLLRQWQTRMLDGLLIVLIVVGLLAIIGGGWSDYMARGAEAIPL
IVAYTTAYAIVLVIALVKRLGFTVRAIALLGLVMAMSALILASDGLLGSGRIAWMGSVVL
AVALFGVRGGIVALAMSLAGFSIVGWFYVGGTLNAAPAQIAVLNTSPSWIGAVTVYVCMT
CLAAVPFMYLLNRLSTLASSATADAARAEANARLAEERAAELERQTVRLQETEHMLRTLI
TTLETPTVPLASGVLLAPIVGQLDSRRAEALVHRLLTVASAERARLMVIDIAGVPAFDTQ
VAQSLLRAAQALELIGCHVALTGISPTTAQTMTTLGIRMDNITIARSPQDILAQR
Download sequence
Identical sequences A5UWK6
WP_011957353.1.23570 gi|148656754|ref|YP_001276959.1| 357808.RoseRS_2635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]