SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_2716 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_2716
Domain Number 1 Region: 435-541
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0084
Further Details:      
 
Domain Number 2 Region: 339-387
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000615
Family HAMP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_2716
Sequence length 559
Comment (Roseiflexus RS-1)
Sequence
MASSARTITPLVLGRDLSLRSRLILGYGIVVSLTLIFGLFMFVHLSAIRNRLEQLSSDVT
IDTRYSIEAFTAIADAQRQVDRYLLQPDESRYRDAVRQFDTLQRTIERLQRDAHNPAMRE
HLKRIQAQAATYRQIFDETSTSITAQQRMRDDLYTMFLQQYQTIEQAISNARPVTSGDYL
ALMDLSRASTRLQLAYVWVGQMESDNTIGAADNAIAELRQARTFLRRYLVLNSQTRVVQP
DDLERLQSVSESFDRSLKSIASLSSAYIRTETLINSRLRPQAGQLSREASALSDTALLQL
TVATKEIDQETARTQTIGGGVLAILLVAGIALGVLLASLITRPLSELVAATARLARGEGE
ARVRPRGGRELVLLAHAFNDMAAELERERAEVRYQNTLLAERATELERALAQLHEETAAR
EQLSATVRQLSVPIIPIMEGVLVAPLVGEIDAERASLLQRRLLERIVAERAQAAILDITG
VPVVDAQVSIWLIQATTAARLLGARCILVGINPEVSQALVASGVDLGDLVTRATLREGLE
YAVKMLRRSSFAMVNGDRR
Download sequence
Identical sequences A5UWT6
357808.RoseRS_2716 gi|148656834|ref|YP_001277039.1| WP_011957433.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]