SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_3231 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_3231
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily GlnB-like 0.00000000000196
Family Prokaryotic signal transducing protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_3231
Sequence length 112
Comment (Roseiflexus RS-1)
Sequence
MKLIIAVVQRQDAGDLIEALTAAGHRVTRISSEGGFLREGNVTLLIAAEDYQVDPILKIV
REHCYTRTRYVSPLPPVAESGEFYPPTPVEVQVGGATVFVVRAADVRRLTPS
Download sequence
Identical sequences A5UY89
gi|148657337|ref|YP_001277542.1| 2014335922 WP_011957936.1.23570 2016901640 2010303717 357808.RoseRS_3231 2010250466 2013962734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]